PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi3g17165.1.p
Common NameBRADI_3g17165, LOC100836777
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family MYB
Protein Properties Length: 342aa    MW: 38024.7 Da    PI: 6.3578
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi3g17165.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.11.8e-171461148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      rg W++eEde+lv++++ +G g+W+ ++++ g+ R++k+c++rw +yl
  Bradi3g17165.1.p 14 RGLWSPEEDEKLVRYITTHGYGCWSEVPEKAGLQRCGKSCRLRWINYL 61
                      788*******************************************97 PP

2Myb_DNA-binding56.75.5e-1867111147
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       rgr+T+eE++l++ +++  G++ W+ Ia++++ gRt++++k++w+++
  Bradi3g17165.1.p  67 RGRFTPEEEKLIISLHAIVGNR-WAHIASHLP-GRTDNEIKNYWNSW 111
                       89********************.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.607.4E-25664IPR009057Homeodomain-like
PROSITE profilePS5129417.1961IPR017930Myb domain
SuperFamilySSF466893.71E-3011108IPR009057Homeodomain-like
SMARTSM007173.3E-121363IPR001005SANT/Myb domain
PfamPF002493.5E-151461IPR001005SANT/Myb domain
CDDcd001677.69E-121761No hitNo description
PROSITE profilePS5129426.38762116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.0E-2565116IPR009057Homeodomain-like
SMARTSM007171.2E-1766114IPR001005SANT/Myb domain
PfamPF002491.2E-1667111IPR001005SANT/Myb domain
CDDcd001671.01E-1369112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:1901430Biological Processpositive regulation of syringal lignin biosynthetic process
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 342 aa     Download sequence    Send to blast
MGHHSCCNQQ KVKRGLWSPE EDEKLVRYIT THGYGCWSEV PEKAGLQRCG KSCRLRWINY  60
LRPDIRRGRF TPEEEKLIIS LHAIVGNRWA HIASHLPGRT DNEIKNYWNS WIKKKIRKHV  120
PAPPASISPT TASPPNSLIA APPCTGSTGT SSVAGGANHR RPLQHPTFSC TADEDEQHHL  180
QLDAFMGPQA QAQQSIVSCG RDEGSPPGGA TMAAAPPPLF MFDTSGPLFA TTPAQEHPFI  240
SSFTAAMAEG GCYGLQLPPL VDGMGAMAMD DHCRYEIVEE QKQQQQRRRP EPELELELEE  300
ERWVDDEQLL MWHDVHDELT TTPSSNLQSD HHSSLLFMGP N*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-27141167108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU7309020.0EU730902.1 Brachypodium distachyon clone BAC DH085B13, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014755642.10.0PREDICTED: myb-related protein Zm38
TrEMBLC3SAD70.0C3SAD7_BRADI; Myb-like DNA-binding domain containing protein
STRINGBRADI3G17165.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP60323757
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G63910.15e-84myb domain protein 103
Publications ? help Back to Top
  1. Huo N, et al.
    Structural characterization of Brachypodium genome and its syntenic relationship with rice and wheat.
    Plant Mol. Biol., 2009. 70(1-2): p. 47-61
    [PMID:19184460]